PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_470V3.3.p
Common NameHAP3D
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YB
Protein Properties Length: 197aa    MW: 22381.2 Da    PI: 4.5191
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_470V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1382.6e-4336126393
             NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       eq+ ++Pia v+rimkk+lP n+kisk+aket+q c sef+sf+t+ea dkcqrekr+ti+gdd+lwa+ +l f+dy+e l++yl+kyr++
  Pp3c17_470V3.3.p  36 EQEPLIPIASVVRIMKKILPHNTKISKEAKETMQLCTSEFVSFITDEAFDKCQREKRRTITGDDVLWAFRSLNFDDYAELLEIYLQKYRQF 126
                       89999************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-4230146IPR009072Histone-fold
SuperFamilySSF471131.77E-3337134IPR009072Histone-fold
PfamPF008081.4E-2241103IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-146886No hitNo description
PRINTSPR006153.1E-1487105No hitNo description
PRINTSPR006153.1E-14106124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MADSGSDKPR SPENDQHPDN ESGGVQLQDH DTIVIEQEPL IPIASVVRIM KKILPHNTKI  60
SKEAKETMQL CTSEFVSFIT DEAFDKCQRE KRRTITGDDV LWAFRSLNFD DYAELLEIYL  120
QKYRQFLEVK FGIQSVGMES NLSNEEGLRF AGLSDGMSGD MNQEGVTVPA ELMLHSYGNE  180
PSPEMMYYLH HMRPPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B6e-3636125392Transcription factor HapC (Eurofung)
4g92_B6e-3636125392Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO233106e-42NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0I9QPW91e-147A0A0I9QPW9_PHYPA; CCAAT-box binding factor HAP3-like protein
STRINGPP1S148_126V6.11e-147(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-43nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Xie Z, et al.
    Duplication and functional diversification of HAP3 genes leading to the origin of the seed-developmental regulatory gene, LEAFY COTYLEDON1 (LEC1), in nonseed plant genomes.
    Mol. Biol. Evol., 2008. 25(8): p. 1581-92
    [PMID:18453547]